MG_019_MONOMER – chaperone protein DnaJ

Name
WID MG_019_MONOMER View in model
Name chaperone protein DnaJ View in model
Cross references PDB: 1XBL
 
Genetics
Gene MG_019 View in model
 
Structure
Sequence
1
51
101
151
201
251
301
351
MAAGKRDYYEVLGISKNASSQDIKRAFRKLAMQYHPDRHKAENETTQKQN
EEKFKEVNEAYEVLSDEEKRKLYDQFGHEGLNASGFHEAGFNPFDIFNSV
FGEGFSFGMDGDSPFDFIFNRSKKRQQQIVVPYNLDIALVIEINFFEMTN
GCNKTIKYERKVSCHSCNGFGAEGGESGLDLCKDCNGNGFVIKNQRSIFG
TIQSQVLCSTCNGQGKQIKVKCKTCRSNKYTVTNQIKEINIPAGMYSGEA
LVDESGGNEFKGHYGKLIIQVNVLASKIFKRSDNNVIANVLVDPMVAIVG
GVIELPTLEGIKEFNIRPGTKSGEQIVIPNGGIKFSKSFKRKAGDLIIII
SYARPCEYTNLELKKLREFIKPNQEVKQYLNTLKNEYKT*
50
100
150
200
250
300
350
390
View in model
Is N‑terminal methionine cleaved
No
View in model
Prosthetic groups View in model
Empirical formula (pH 7.5) H3061C1942N534O585S16
Molecular weight (pH 7.5; Da) 43762.23 View in model
Extinction coefficient 
(260 nm, 25C, pH 7.0)
22110
Instability index 31.81
Is stable True
Aliphatic index 75.72
GRAVY (25C, pH 7.0) -0.496
Half life (OD (600 nm) = 0.3, 
M9 media, 36C; min)
1200 View in model
 
Synthesis
Localization c View in model
 
Function
Complex subunit chaperone protein DnaJ
[c]: (2) MG_019_MONOMERMG_019_DIMER
View in model
 
Comments
Comments Functional Macromolecule Functional as homodimer [PUB_0096]. Coenzymes Interacts with 2 ZN per monomer as prosthetic group [96].
References
  1. UniProt Consortium. The Universal Protein Resource (UniProt) 2009. Nucleic Acids Res 37, D169-74 (2009). WholeCell: PUB_0096, PubMed: 18836194, URL: http://www.uniprot.org/uniprot/

 
Metadata
Created 2012-10-01 15:07:44
Last updated 2012-10-01 15:14:21