MG_014_MONOMER – multidrug ABC transporter, ATP-binding/permease protein

Name
WID MG_014_MONOMER View in model
Name multidrug ABC transporter, ATP-binding/permease protein View in model
 
Genetics
Gene MG_014 View in model
 
Structure
Sequence
1
51
101
151
201
251
301
351
401
451
501
551
601
MGLVLKEFNNKIRTALILAPFFTFAQIVIDLIIPSFLASAISVVFSIDKL
KQDESGGKTISVDFIGGANINFANVREAQIVLATTVILLALCGLFFGLIS
IYCASYVSANTSFLLRKKIFAKLMRITTPSHDHYGSSTLLVRLTNDVYLM
EVIAFDFLRLIIRAPLLFIGGLVFAVTTNQDMSISLLITFPLILLVIGIL
NRKSIPLFKENQKSVDKINERVEEDVSGYKVIQSFNLHSFTNNKFKIANE
GWKKNSTSSLFINSLNIPFTFFLSSLTIIIALLLVFQLDSSVSVDPLPQD
AAIRPNIFAFFQYNFYIVLGFILTSLTMVNFNRSRVALGRIKDILSQPEI
KTITNKDQKELLPTLEFRNISFGLGNKNNNNFLQNLSFKFEAYKTYGIVG
PTGSGKSLIANIIGGLYEPNEGEILIGGEKIQSIDSLYLSEMIGIVFQQN
ILFKGTISSNIKIGIETRSDWKNQSDLQKNEAMKNAAKIACADTFIEKFS
DSYDHNVEQLGKNLSGGQKQRVAIARTLITKPRILVFDDSMSALDALTEK
KVRENIENDLKLTTKIIISQNINSIKHADKILVIDNGRIVGFDSDQKLMK
NCSLYQKMKESQKDLGGDFDAVN*
50
100
150
200
250
300
350
400
450
500
550
600
624
View in model
Is N‑terminal methionine cleaved
No
View in model
Empirical formula (pH 7.5) H5079C3171N812O908S14
Molecular weight (pH 7.5; Da) 69554.86 View in model
Extinction coefficient 
(260 nm, 25C, pH 7.0)
30870
Instability index 36.74
Is stable True
Aliphatic index 112.04
GRAVY (25C, pH 7.0) 0.162
Half life (OD (600 nm) = 0.3, 
M9 media, 36C; min)
1200 View in model
 
Synthesis
Localization m View in model
 
Function
Complex subunit multidrug ABC transporter
[m]: MG_014_MONOMER + MG_015_MONOMERMG_014_015_DIMER
View in model
 
Comments
Comments Functional Macromolecule Functional as heterodimer with MG_015_MONOMER [PUB_0243].
References
  1. van Veen HW, Konings WN. The ABC family of multidrug transporters in microorganisms. Biochim Biophys Acta 1365, 31-6 (1998). WholeCell: PUB_0243, PubMed: 9693718

 
Metadata
Created 2012-10-01 15:07:43
Last updated 2012-10-01 15:14:21