MG_012_MONOMER – alpha-L-glutamate ligase

Name
WID MG_012_MONOMER View in model
Name alpha-L-glutamate ligase View in model
 
Genetics
Gene MG_012 View in model
 
Structure
Sequence
1
51
101
151
201
251
MKKINVVYNPAFNPISSKLNQTQLLKNASEELDIELKFFTSFDINTTKAK
ANLPFISNKILFMDKNIALARWLESNGFEVINSSIGINNADNKGLSHAII
AQYPFIKQIKTLLGPQNFDREWNPVMLDVFINQIKQSMEFPVIVKSVFGS
FGDYVFLCLDEQKLRKTLMSFNQQAIVQKYITCSKGESVRVIVVNNKVIG
ALHTTNNSDFRSNLNKGAKAERFFLNKEQENLAVKISKVMQLFYCGIDFL
FDQDRSLIFCEVNPNVQLTRSSMYLNTNLAIELLKAI*
50
100
150
200
250
288
View in model
Is N‑terminal methionine cleaved
No
View in model
Prosthetic groups View in model
Empirical formula (pH 7.5) H2354C1485N387O423S11
Molecular weight (pH 7.5; Da) 32749.54 View in model
Extinction coefficient 
(260 nm, 25C, pH 7.0)
20440
Instability index 35.68
Is stable True
Aliphatic index 99.17
GRAVY (25C, pH 7.0) -0.0646
Half life (OD (600 nm) = 0.3, 
M9 media, 36C; min)
1200 View in model
 
Synthesis
Localization c View in model
 
Function
Enzyme alpha-L-glutamate ligase
[c]: (4) ATP + (4) GLU + (4) H2O ⇒ (4) ADP + (4) H + (4) H2O + (4) PI
View in model
 
Comments
Comments Functional Macromolecule Functional as monomer [PUB_0239]. Coenzymes Interacts with 2 MN per monomer as prosthetic group [96].
References
  1. Galperin MY, Koonin EV. A diverse superfamily of enzymes with ATP-dependent carboxylate-amine/thiol ligase activity. Protein Sci 6, 2639-43 (1997). WholeCell: PUB_0239, PubMed: 9416615

 
Metadata
Created 2012-10-01 15:07:43
Last updated 2012-10-01 15:14:21