MG_011_MONOMER

Name
WID MG_011_MONOMER View in model
 
Genetics
Gene MG_011 View in model
 
Structure
Sequence
1
51
101
151
201
251
MGKIKLKNRKALVVYDNKDDFEKNQTFALSLIKELQKKKLNAEVLLLENK
DINFEAKINEAELILNRSRKVDFLKTNNQINTFLVNPFNVVFIANDKYET
YKWLKQNRFLTVNSSLLSKETIKSFPVIVKKRNSHGGKDVHLVNSADEIK
HLNIENATEWIVQPFLSIGTVEYRAYILFGKIIKVIKKISNANQFKANFS
QGAEVSLFKLKWFTKRKIKKIAKRLREGYYAIDFFLNRYNRVIVNEIEDA
AGARALVQLCPDLNITKIIIRTIISKFKKFLKKKLIS*
50
100
150
200
250
288
View in model
Is N‑terminal methionine cleaved
No
View in model
Empirical formula (pH 7.5) H2515C1541N412O412S2
Molecular weight (pH 7.5; Da) 33470.00 View in model
Extinction coefficient 
(260 nm, 25C, pH 7.0)
28545
Instability index 20.06
Is stable True
Aliphatic index 106.63
GRAVY (25C, pH 7.0) -0.261
Half life (OD (600 nm) = 0.3, 
M9 media, 36C; min)
1200 View in model
 
Synthesis
Localization c View in model
 
Metadata
Created 2012-10-01 15:07:43
Last updated 2012-10-01 15:14:20