MG_010_MONOMER – DNA primase-related protein

Name
WID MG_010_MONOMER View in model
Name DNA primase-related protein View in model
 
Genetics
Gene MG_010 View in model
 
Structure
Sequence
1
51
101
151
201
MDVRTERLNELFFVYHKNLKNQSKSKYSRAVNYLKRRGFNLQDFLKVGGG
VGYLQNKEWLNLPLYSFDGNLIGFLNRKVSYKKEFLYTPFNKPPSKSEAF
VGLRELVIKDNSIYLVEGDFDWLAFRKAGILNSLPLCGLTISNQQVQWLK
QKKIKKIFICFDNDLAGKNGAKNLKEYLTKQGFITKVIEIKAAAKDWNDL
FLLNNSNWSAVLTNQLLF*
50
100
150
200
219
View in model
Is N‑terminal methionine cleaved
No
View in model
Empirical formula (pH 7.5) H1834C1171N305O314S3
Molecular weight (pH 7.5; Da) 25305.07 View in model
Extinction coefficient 
(260 nm, 25C, pH 7.0)
41160
Instability index 29.27
Is stable True
Aliphatic index 95.25
GRAVY (25C, pH 7.0) -0.312
Half life (OD (600 nm) = 0.3, 
M9 media, 36C; min)
1200 View in model
 
Synthesis
Localization c View in model
 
Metadata
Created 2012-10-01 15:07:43
Last updated 2012-10-01 15:14:20