MG_008_MONOMER – tRNA modification GTPase TrmE

Name
WID MG_008_MONOMER View in model
Name tRNA modification GTPase TrmE View in model
Cross references PDB: 2GJA
 
Genetics
Gene MG_008 View in model
 
Structure
Sequence
1
51
101
151
201
251
301
351
401
MKSEINIFALATAPFNSALHIIRFSGPDVYEILNKITNKKITRKGMQIQR
TWIVDENNKRIDDVLLFKFVSPNSYTGEDLIEISCHGNMLIVNEICALLL
KKGGVYAKPGEFTQRSFLNGKMSLQQASAVNKLILSPNLLVKDIVLNNLA
GEMDQQLEQIAQQVNQLVMQMEVNIDYPEYLDEQVELSTLNNKVKLIIEK
LKRIIENSKQLKKLHDPFKIAIIGETNVGKSSLLNALLNQDKAIVSNIKG
STRDVVEGDFNLNGYLIKILDTAGIRKHKSGLEKAGIKKSFESIKQANLV
IYLLDATHPKKDLELISFFKKNKKDFFVFYNKKDLITNKFENSISAKQKD
IKELVDLLTKYINEFYKKIDQKIYLIENWQQILIEKIKEQLEQFLKQQKK
YLFFDVLVTHLREAQQDILKLLGKDVGFDLVNEIFNNFCLGK*
50
100
150
200
250
300
350
400
443
View in model
Is N‑terminal methionine cleaved
No
View in model
Prosthetic groups
  • (None) K [c]

View in model
Empirical formula (pH 7.5) H3745C2313N599O660S10
Molecular weight (pH 7.5; Da) 50825.60 View in model
Extinction coefficient 
(260 nm, 25C, pH 7.0)
29255
Instability index 34.27
Is stable True
Aliphatic index 110.45
GRAVY (25C, pH 7.0) -0.221
Half life (OD (600 nm) = 0.3, 
M9 media, 36C; min)
1200 View in model
 
Synthesis
Localization c View in model
 
Function
Complex subunit tRNA uridine 5-carboxymethylaminomethyl modification enzyme
[c]: (2) MG_008_MONOMER + (2) MG_379_MONOMERMG_008_379_TETRAMER
View in model
 
Comments
Comments Functional Macromolecule Functional as heterotetramer (see MG_008_379_TETRAMER) [PUB_0096]. Coenzymes Monomer interacts with K with unknown stoichiometry as prosthetic group [216].
References
  1. UniProt Consortium. The Universal Protein Resource (UniProt) 2009. Nucleic Acids Res 37, D169-74 (2009). WholeCell: PUB_0096, PubMed: 18836194, URL: http://www.uniprot.org/uniprot/

 
Metadata
Created 2012-10-01 15:07:43
Last updated 2012-10-01 15:14:20