MG_007_MONOMER – DNA polymerase III delta prime subunit, putative

Name
WID MG_007_MONOMER View in model
Name DNA polymerase III delta prime subunit, putative View in model
Cross references PDB: 1XXI
 
Genetics
Gene MG_007 View in model
 
Structure
Sequence
1
51
101
151
201
251
MLTTTHALLIIQRKGSFLKPFLDNYLTSIVCENKNGCKKCINCLEILNNK
YNSLYWFDQINPFKRENALQLARIFNRERTSVNNKNIYLIEEIEKLSSNS
INSLLRLVEDSPINSYGIFTTKNESLILSTFLSRVQKVVLKKASKVPFKV
SKNDQEIITSFFTVDEQIEAIENGSFNRFKIILDACLNKKTGTEQIYHAW
QIFRDFSNSEIAQLITLIINKTENIDKKSILFNCLKVLPYNPPKSTLFAN
LVSW
50
100
150
200
250
254
View in model
Is N‑terminal methionine cleaved
No
View in model
Empirical formula (pH 7.5) H2133C1334N348O384S7
Molecular weight (pH 7.5; Da) 29414.68 View in model
Extinction coefficient 
(260 nm, 25C, pH 7.0)
27680
Instability index 45.41
Is stable False
Aliphatic index 103.62
GRAVY (25C, pH 7.0) -0.170
Half life (OD (600 nm) = 0.3, 
M9 media, 36C; min)
1200 View in model
 
Synthesis
Localization c View in model
 
Function
Complex subunit DNA-directed DNA polymerase gamma complex
[c]: MG_007_MONOMER + MG_315_MONOMER + (4) MG_419_MONOMERDNA_POLYMERASE_GAMMA_COMPLEX
View in model
 
Comments
Comments Functional Macromolecule Functional as heterocomplex (see DNA_POLYMERASE_GAMMA_COMPLEX) [PUB_0312, PUB_0313, PUB_0314].
References
  1. Bruck I, O'Donnell M. The DNA replication machine of a gram-positive organism. J Biol Chem 275, 28971-83 (2000). WholeCell: PUB_0314, PubMed: 10878011

  2. Kelman Z, O'Donnell M. DNA polymerase III holoenzyme: structure and function of a chromosomal replicating machine. Annu Rev Biochem 64, 171-200 (1995). WholeCell: PUB_0312, PubMed: 7574479

  3. Razin S, Yogev D, Naot Y. Molecular biology and pathogenicity of mycoplasmas. Microbiol Mol Biol Rev 62, 1094-156 (1998). WholeCell: PUB_0313, PubMed: 9841667

 
Metadata
Created 2012-10-01 15:07:43
Last updated 2012-10-01 15:14:20