MG_005_MONOMER – seryl-tRNA synthetase

Name
WID MG_005_MONOMER View in model
Name seryl-tRNA synthetase View in model
 
Genetics
Gene MG_005 View in model
 
Structure
Sequence
1
51
101
151
201
251
301
351
401
MLDPNKLRNNYDFFKKKLLERNVNEQLLNQFIQTDKLMRKNLQQLELANQ
KQSLLAKQVAKQKDNKKLLAESKELKQKIENLNNAYKDSQNISQDLLLNF
PNIAHESVPVGKNESANLELLKEGRKPVFDFKPLPHRELCEKLNLVAFDK
ATKISGTRFVAYTDKAAKLLRAITNLMIDLNKSKYQEWNLPVVINELSLR
STGQLPKFKDDVFKLENTRYYLSPTLEVQLINLHANEIFNEEDLPKYYTA
TGINFRQEAGSAGKQTKGTIRLHQFQKTELVKFCKPENAINELEAMVRDA
EQILKALKLPFRRLLLCTGDMGFSAEKTYDLEVWMAASNEYREVSSCSSC
GDFQARRAMIRYKDINNGKNSYVATLNGTALSIDRIFAAILENFQTKDGK
ILIPQALKKYLDFDTIK*
50
100
150
200
250
300
350
400
418
View in model
Is N‑terminal methionine cleaved
No
View in model
Empirical formula (pH 7.5) H3463C2147N588O632S12
Molecular weight (pH 7.5; Da) 48009.67 View in model
Extinction coefficient 
(260 nm, 25C, pH 7.0)
30995
Instability index 33.53
Is stable True
Aliphatic index 91.29
GRAVY (25C, pH 7.0) -0.528
Half life (OD (600 nm) = 0.3, 
M9 media, 36C; min)
1200 View in model
 
Synthesis
Localization c View in model
Chaperones MG_305_MONOMER View in model
 
Function
Complex subunit seryl-tRNA synthetase
[c]: (2) MG_005_MONOMERMG_005_DIMER
View in model
 
Comments
Comments Functional Macromolecule Functional as homodimer.
 
Metadata
Created 2012-10-01 15:07:43
Last updated 2012-10-01 15:14:20