MG_003_MONOMER – DNA gyrase, B subunit

Name
WID MG_003_MONOMER View in model
Name DNA gyrase, B subunit View in model
Cross references PDB: 1KZN
 
Genetics
Gene MG_003 View in model
 
Structure
Sequence
1
51
101
151
201
251
301
351
401
451
501
551
601
651
MEENNKANIYDSSSIKVLEGLEAVRKRPGMYIGSTGEEGLHHMIWEIVDN
SIDEAMGGFASFVKLTLEDNFVTRVEDDGRGIPVDIHPKTNRSTVETVFT
VLHAGGKFDNDSYKVSGGLHGVGASVVNALSSSFKVWVFRQNKKYFLSFS
DGGKVIGDLVQEGNSEKEHGTIVEFVPDFSVMEKSDYKQTVIVSRLQQLA
FLNKGIRIDFVDNRKQNPQSFSWKYDGGLVEYIHHLNNEKEPLFNEVIAD
EKTETVKAVNRDENYTVKVEVAFQYNKTYNQSIFSFCNNINTTEGGTHVE
GFRNALVKIINRFAVENKFLKDSDEKINRDDVCEGLTAIISIKHPNPQYE
GQTKKKLGNTEVRPLVNSVVSEIFERFMLENPQEANAIIRKTLLAQEARR
RSQEARELTRRKSPFDSGSLPGKLADCTTRDPSISELYIVEGDSAGGTAK
TGRDRYFQAILPLRGKILNVEKSNFEQIFNNAEISALVMAIGCGIKPDFE
LEKLRYSKIVIMTDADVDGAHIRTLLLTFFFRFMYPLVEQGNIFIAQPPL
YKVSYSHKDLYMHTDVQLEQWKSQNPNVKFGLQRYKGLGEMDALQLWETT
MDPKVRTLLKVTVEDASIADKAFSLLMGDEVPPRREFIEKNARSVKNIDI
*
50
100
150
200
250
300
350
400
450
500
550
600
650
651
View in model
Is N‑terminal methionine cleaved
Yes
View in model
Empirical formula (pH 7.5) H5147C3282N896O994S17
Molecular weight (pH 7.5; Da) 73605.29 View in model
Extinction coefficient 
(260 nm, 25C, pH 7.0)
56310
Instability index 37.09
Is stable True
Aliphatic index 83.95
GRAVY (25C, pH 7.0) -0.418
Half life (OD (600 nm) = 0.3, 
M9 media, 36C; min)
1200 View in model
 
Synthesis
Localization c View in model
 
Function
Complex subunit DNA gyrase
[c]: (2) MG_003_MONOMER + (2) MG_004_MONOMERDNA_GYRASE
View in model
 
Comments
Comments Functional Macromolecule Functional as heterotetramer ((2) MG_003_MONOMER, (2) MG_004_MONOMER) [PUB_0096]. N-terminal methionine cleavage Shewanella oneidensis MR-1 homolog undergoes N-terminal methionine cleavage [PUB_0280].
References
  1. Gupta N, Tanner S, Jaitly N, Adkins JN, Lipton M, Edwards R, Romine M, Osterman A, Bafna V, Smith RD, Pevzner PA. Whole proteome analysis of post-translational modifications: applications of mass-spectrometry for proteogenomic annotation. Genome Res 17, 1362-77 (2007). WholeCell: PUB_0280, PubMed: 17690205

  2. UniProt Consortium. The Universal Protein Resource (UniProt) 2009. Nucleic Acids Res 37, D169-74 (2009). WholeCell: PUB_0096, PubMed: 18836194, URL: http://www.uniprot.org/uniprot/

 
Metadata
Created 2012-10-01 15:07:43
Last updated 2012-10-01 15:14:20