MG_002_MONOMER – DnaJ domain protein

Name
WID MG_002_MONOMER View in model
Name DnaJ domain protein View in model
 
Genetics
Gene MG_002 View in model
 
Structure
Sequence
1
51
101
151
201
251
301
MNLYDLLELPTTASIKEIKIAYKRLAKRYHPDVNKLGSQTFVEINNAYSI
LSDPNQKEKYDSMLKVNDFQNRIKNLDISVRWHENFMEELELRKNWEFDF
FSSDEDFFYSPFTKNKYASFLDKDVSLAFFQLYSKGKIDHQLEKSLLKRR
DVKEACQQNKNFIEVIKEQYNYFGWIEAKRYFNINVELELTQREIRDRDV
VNLPLKIKVINNDFPNQLWYEIYKNYSFRLSWDIKNGEIAEFFNKGNRAL
GWKGDLIVRMKVVNKVNKRLRIFSSFFENDKSKLWFLVPNDKQSNPNKGV
FNYKTQHFID*
50
100
150
200
250
300
311
View in model
Is N‑terminal methionine cleaved
No
View in model
Empirical formula (pH 7.5) H2619C1715N451O480S5
Molecular weight (pH 7.5; Da) 37395.10 View in model
Extinction coefficient 
(260 nm, 25C, pH 7.0)
60975
Instability index 40.55
Is stable False
Aliphatic index 80.51
GRAVY (25C, pH 7.0) -0.685
Half life (OD (600 nm) = 0.3, 
M9 media, 36C; min)
1200 View in model
 
Synthesis
Localization c View in model
Chaperones MG_392_393_21MER View in model
 
Metadata
Created 2012-10-01 15:07:43
Last updated 2012-10-01 15:14:20