MG_001_MONOMER – DNA polymerase III, beta subunit

Name
WID MG_001_MONOMER View in model
Name DNA polymerase III, beta subunit View in model
Cross references PDB: 1OK7, PDB: 3BEP
 
Genetics
Gene MG_001 View in model
 
Structure
Sequence
1
51
101
151
201
251
301
351
MKILINKSELNKILKKMNNVIISNNKIKPHHSYFLIEAKEKEINFYANNE
YFSVKCNLNKNIDILEQGSLIVKGKIFNDLINGIKEEIITIQEKDQTLLV
KTKKTSINLNTINVNEFPRIRFNEKNDLSEFNQFKINYSLLVKGIKKIFH
SVSNNREISSKFNGVNFNGSNGKEIFLEASDTYKLSVFEIKQETEPFDFI
LESNLLSFINSFNPEEDKSIVFYYRKDNKDSFSTEMLISMDNFMISYTSV
NEKFPEVNYFFEFEPETKIVVQKNELKDALQRIQTLAQNERTFLCDMQIN
SSELKIRAIVNNIGNSLEEISCLKFEGYKLNISFNPSSLLDHIESFESNE
INFDFQGNSKYFLITSKSEPELKQILVPSR
50
100
150
200
250
300
350
380
View in model
Is N‑terminal methionine cleaved
No
View in model
DNA footprint Length: 25 (nt), Binding: ssDNA, Region: xsDNA View in model
Empirical formula (pH 7.5) H3136C2002N510O605S9
Molecular weight (pH 7.5; Da) 44317.83 View in model
Extinction coefficient 
(260 nm, 25C, pH 7.0)
16765
Instability index 38.61
Is stable True
Aliphatic index 91.79
GRAVY (25C, pH 7.0) -0.417
Half life (OD (600 nm) = 0.3, 
M9 media, 36C; min)
1200 View in model
 
Synthesis
Localization c View in model
 
Function
Enzyme View in model
Reaction participant View in model
Complex subunit View in model
 
Comments
Comments Functional Macromolecule Functional as monomer [PUB_0312, PUB_0313, PUB_0314]. 2 copies assemble into DNA polymerase III holoenzyme [PUB_0312, PUB_0313, PUB_0314]. DNA-binding DNA polymerase III preinitiation complex (γ-complex and β-subunit) has 51 nt footprint [PUB_0743]. Assuming the γ-complex and β-subunit contribute equally to the footprint, we conclude that each has a footprint 25-26 nt.
References
  1. Bruck I, O'Donnell M. The DNA replication machine of a gram-positive organism. J Biol Chem 275, 28971-83 (2000). WholeCell: PUB_0314, PubMed: 10878011

  2. Kelman Z, O'Donnell M. DNA polymerase III holoenzyme: structure and function of a chromosomal replicating machine. Annu Rev Biochem 64, 171-200 (1995). WholeCell: PUB_0312, PubMed: 7574479

  3. Razin S, Yogev D, Naot Y. Molecular biology and pathogenicity of mycoplasmas. Microbiol Mol Biol Rev 62, 1094-156 (1998). WholeCell: PUB_0313, PubMed: 9841667

  4. Reems JA, McHenry CS. Escherichia coli DNA polymerase III holoenzyme footprints three helical turns of its primer. J Biol Chem 269, 33091-6 (1994). WholeCell: PUB_0743, PubMed: 7806536

 
Metadata
Created 2012-10-01 15:07:43
Last updated 2012-10-01 15:14:20